PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 881733
Common NameARALYDRAFT_681177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 626aa    MW: 70872.8 Da    PI: 7.4983
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
881733genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.31.2e-22126227199
             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
             f k+lt+sd++++g l++ k++a+e+     +++ +  + l+ +d++gr+W++k+++r++++r+++t+GW+ F+  ++L +gD +vF   + +++el v+++r
  881733 126 FSKILTSSDANTHGGLSILKRHATEClppldMSQRTPMQHLVAKDLHGREWTFKHSFRGTPRRHLFTSGWSLFATTKRLIVGDAFVFL--RGENGELGVGIRR 226
             889***************************8434444457999*********************************************..4499999****99 PP

             S CS
      B3  99 k 99 
             +
  881733 227 A 227
             7 PP

2Auxin_resp98.31.1e-32252331183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 +++a+++k+ F vvY+P+  +s+Fvv+++k+++a+++k++vG+Rf+m+fe++d+se+r+sGt++gv+d++p +W++S+WrsL+
      881733 252 VVNAFKSKCKFIVVYKPS--SSQFVVNYDKFVDAMNNKFIVGSRFRMRFEGQDFSEKRYSGTIIGVNDMSP-HWKDSEWRSLQ 331
                 6899*************8..59*************************************************.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.6E-34119238IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.1E-27119235IPR015300DNA-binding pseudobarrel domain
CDDcd100171.10E-20125226No hitNo description
SMARTSM010195.6E-21126228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.182126228IPR003340B3 DNA binding domain
PfamPF023624.3E-20126227IPR003340B3 DNA binding domain
PfamPF065072.4E-28253331IPR010525Auxin response factor
PfamPF023097.5E-7504548IPR033389AUX/IAA domain
SuperFamilySSF542777.26E-8509588No hitNo description
PROSITE profilePS5174520.844512593IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MENNEELNAQ PELLGIIDRT QTYMYEQLWK ICAGPLCDLP KPGETIYYFP QGHIELIEAS  60
TKDELDQIRP HFDLPSKLRC CVDDIQLKID QNTDDVYAEI YLMPDTTDVI TPITTMDNQR  120
PMVYSFSKIL TSSDANTHGG LSILKRHATE CLPPLDMSQR TPMQHLVAKD LHGREWTFKH  180
SFRGTPRRHL FTSGWSLFAT TKRLIVGDAF VFLRGENGEL GVGIRRARHQ LGHKPSLVIS  240
TQCMKDGVIA SVVNAFKSKC KFIVVYKPSS SQFVVNYDKF VDAMNNKFIV GSRFRMRFEG  300
QDFSEKRYSG TIIGVNDMSP HWKDSEWRSL QVQWDELSPF PRPDKVSPWE IEHLIPSSSI  360
SQPTVLQKKR ARQCNEIGST SSNLLTGQEI GQSSLSSPKS VPEFSCRDAV EDSKFPSDWL  420
MSDLVPAIPK PNNNNNQLVQ QTKEKITTEA TTSCILFGVD LTKASKTKDP MGPIEATETT  480
TSCILSQDKK LDQTLTWTSP KEVQSSKFNS TRRRIKVQMQ GVVIGRAVDL TVFHGYNQLI  540
QKLEELFDLK DELRSRNQWE IVFINNEGNV MPLGDDPWPE FCNMAKKIFI GSKEEIEKMK  600
SRNKVSQAKS TVLTSSSDVP PNVKA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1222736222360Auxin response factor 1
4ldw_A1e-1222736222360Auxin response factor 1
4ldv_A1e-1222736222360Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893812.10.0predicted protein
SwissprotQ9FX250.0ARFM_ARATH; Auxin response factor 13
TrEMBLD7KJF30.0D7KJF3_ARALL; Auxin response factor
STRINGAl_scaffold_0001_35000.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34170.30.0AUXIN RESPONSE FACTOR 13